Lyophilisate in a glass vial
VIP
Also known as: aviptadil · vasoactive intestinal peptide
Neuropeptide of 28 amino acids, vasoactive intestinal peptide, C-terminally amidated.
Often ordered together
Together:
- Ships 24–48 h after payment
- Minimum order €200
- Order without registering
Bitcoin
Specification
| Form | Lyophilisate in a glass vial |
|---|---|
| Variants | 5 mg |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| CAS number | 40077-57-4 |
| Molecular formula | C147H237N43O43S |
| Molar mass (computed) | 3326.8 g/mol |
| Storage | As stated in the lot's safety data sheet |
Reference data for the compound from PubChem. These are not lot results. The CoA of the delivered lot is authoritative.
Buy VIP: price and shipping
Order VIP online from Alpenpeptid: from €37.99, in VIP 5 mg. Every size shows its price per mg, and larger sizes cost less per mg. Dispatch within 24 to 48 hours of payment, across Germany, to Austria, Switzerland, the EU and Europe. Pay by SEPA, Revolut or Bitcoin, without registering. For laboratory research only.
Good to know
Documents and analyses
Earlier analyses and our test methods are in the Quality section. An earlier analysis is not a certificate of analysis for the current lot. Go to Quality
Shipping and delivery time
We dispatch within 24 to 48 hours of receiving payment, to Germany, the EU and the UK. Zones, costs and delivery times
Payment
SEPA and Revolut: you get the payment details by email after ordering. Bitcoin: the amount and address are on the order page, where you also report the transaction ID and payment receipt. Common questions
Further reading
- How to read a peptide certificate of analysis (CoA)
- Peptide content vs purity: the difference explained
- Storing peptides: fridge, freezer and lyophilisate
- Peptide Nomenclature Explained: Why the Same Substance Has Several Names
For laboratory research use only. Not for use in humans or animals.
